PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco025780.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family WRKY
Protein Properties Length: 350aa    MW: 39503.8 Da    PI: 8.1452
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco025780.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY97.31e-30138193359
                  -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  DgynWrKYGqK+vkg efp sYY+Ct a+C vkk+vers  d+++ ei+Y+geHnh+
  Aco025780.1 138 DGYNWRKYGQKQVKGGEFPHSYYKCTAAKCDVKKQVERSF-DGNIKEIIYKGEHNHQ 193
                  9***************************************.***************8 PP

2WRKY95.24.6e-30271329159
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  ldDg++WrKYGqK vkg+++prsYY+Ct  gC+v+k+vers++dpk+  +tYe++Hnh+
  Aco025780.1 271 LDDGHKWRKYGQKYVKGNNHPRSYYKCTNVGCNVRKRVERSKKDPKAALTTYEDKHNHD 329
                  59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.1E-26126194IPR003657WRKY domain
PROSITE profilePS5081121.287131195IPR003657WRKY domain
SuperFamilySSF1182901.31E-23134194IPR003657WRKY domain
SMARTSM007748.0E-31136194IPR003657WRKY domain
PfamPF031061.6E-22138193IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.6E-31259331IPR003657WRKY domain
SuperFamilySSF1182901.44E-27263331IPR003657WRKY domain
PROSITE profilePS5081133.281266331IPR003657WRKY domain
SMARTSM007742.7E-33271330IPR003657WRKY domain
PfamPF031064.0E-23272329IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MAYPSRSFSP KILLRCRKRC RRCVEFWSKA INVVAFSSTA PYYDACSHHV TYLPLWGHHS  60
LQAKPDSCAY LQPAYQSSLP QQILNPFLQP TPRIAGAPSL NYELLFHESG GAFEPVGDPY  120
SDKTSQMSNL AVEKPPGDGY NWRKYGQKQV KGGEFPHSYY KCTAAKCDVK KQVERSFDGN  180
IKEIIYKGEH NHQPSQNRRG EEGGYDDDDT ESKFENSSVS NDEDEDGTAI NEGDSKSSPK  240
MWVAINRDTE SVESTSQRML VLQTISETDL LDDGHKWRKY GQKYVKGNNH PRSYYKCTNV  300
GCNVRKRVER SKKDPKAALT TYEDKHNHDV PKARSTSHNT VSAEPASDN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A6e-31138331877Probable WRKY transcription factor 4
2lex_A6e-31138331877Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009408606.11e-76PREDICTED: probable WRKY transcription factor 3
SwissprotQ9ZQ702e-67WRKY3_ARATH; Probable WRKY transcription factor 3
TrEMBLM0TDK15e-77M0TDK1_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P00610_0012e-76(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP134538122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03340.16e-67WRKY DNA-binding protein 3